Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NDUFA8 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00004702-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human NDUFA8 protein.
  • Immunogen:
  • NDUFA8 (NP_055037.1, 1 a.a. ~ 172 a.a) full-length human protein.
  • Sequence:
  • MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NDUFA8 expression in transfected 293T cell line (H00004702-T01) by NDUFA8 MaxPab polyclonal antibody.

    Lane 1: NDUFA8 transfected lysate(18.92 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4702
  • Gene Name:
  • NDUFA8
  • Gene Alias:
  • CI-19KD,CI-PGIV,MGC793,PGIV
  • Gene Description:
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa
  • Gene Summary:
  • The protein encoded by this gene belongs to the complex I 19 kDA subunit family. Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays an important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq
  • Other Designations:
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8 (19kD, PGIV),NADH-ubiquinone oxidoreductase 19 kDa subunit,NADH:ubiquinone oxidoreductase PGIV subunit,OTTHUMP00000022034
  • RSS
  • YouTube
  • Linkedin
  • Facebook