Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NDUFA5 (Human) Recombinant Protein (P01)

  • Catalog # : H00004698-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NDUFA5 full-length ORF ( NP_004991.1, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 39.9
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004698-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4698
  • Gene Name:
  • NDUFA5
  • Gene Alias:
  • B13,CI-13KD-B,DKFZp781K1356,FLJ12147,NUFM,UQOR13
  • Gene Description:
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa
  • Gene Summary:
  • The human NDUFA5 gene codes for the B13 subunit of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. The high degree of conservation of NDUFA5 extending to plants and fungi indicates its functional significance in the enzyme complex. The protein localizes to the inner mitochondrial membrane as part of the 7 component-containing, water soluble "iron-sulfur protein" (IP) fraction of complex I, although its specific role is unknown. It is assumed to undergo post-translational removal of the initiator methionine and N-acetylation of the next amino acid. The predicted secondary structure is primarily alpha helix, but the carboxy-terminal half of the protein has high potential to adopt a coiled-coil form. The amino-terminal part contains a putative beta sheet rich in hydrophobic amino acids that may serve as mitochondrial import signal. Related pseudogenes have also been identified on four other chromosomes. [provided by RefSeq
  • Other Designations:
  • Complex I-13KD-B,NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5,NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5 (13kD, B13),type I dehydrogenase,ubiquinone reductase
  • RSS
  • YouTube
  • Linkedin
  • Facebook