Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Disease

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NDUFA5 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00004698-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human NDUFA5 protein.
  • Immunogen:
  • NDUFA5 (NP_004991.1, 1 a.a. ~ 116 a.a) full-length human protein.
  • Sequence:
  • MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NDUFA5 expression in transfected 293T cell line (H00004698-T02) by NDUFA5 MaxPab polyclonal antibody.

    Lane 1: NDUFA5 transfected lysate(13.50 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4698
  • Gene Name:
  • NDUFA5
  • Gene Alias:
  • B13,CI-13KD-B,DKFZp781K1356,FLJ12147,NUFM,UQOR13
  • Gene Description:
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa
  • Gene Summary:
  • The human NDUFA5 gene codes for the B13 subunit of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. The high degree of conservation of NDUFA5 extending to plants and fungi indicates its functional significance in the enzyme complex. The protein localizes to the inner mitochondrial membrane as part of the 7 component-containing, water soluble "iron-sulfur protein" (IP) fraction of complex I, although its specific role is unknown. It is assumed to undergo post-translational removal of the initiator methionine and N-acetylation of the next amino acid. The predicted secondary structure is primarily alpha helix, but the carboxy-terminal half of the protein has high potential to adopt a coiled-coil form. The amino-terminal part contains a putative beta sheet rich in hydrophobic amino acids that may serve as mitochondrial import signal. Related pseudogenes have also been identified on four other chromosomes. [provided by RefSeq
  • Other Designations:
  • Complex I-13KD-B,NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5,NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5 (13kD, B13),type I dehydrogenase,ubiquinone reductase
  • RSS
  • YouTube
  • Linkedin
  • Facebook