NDUFA5 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human NDUFA5 protein.
Immunogen
NDUFA5 (NP_004991.1, 1 a.a. ~ 116 a.a) full-length human protein.
Sequence
MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NDUFA5 expression in transfected 293T cell line (H00004698-T01) by NDUFA5 MaxPab polyclonal antibody.
Lane 1: NDUFA5 transfected lysate(12.76 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — NDUFA5
Entrez GeneID
4698GeneBank Accession#
NM_005000.2Protein Accession#
NP_004991.1Gene Name
NDUFA5
Gene Alias
B13, CI-13KD-B, DKFZp781K1356, FLJ12147, NUFM, UQOR13
Gene Description
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa
Omim ID
601677Gene Ontology
HyperlinkGene Summary
The human NDUFA5 gene codes for the B13 subunit of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. The high degree of conservation of NDUFA5 extending to plants and fungi indicates its functional significance in the enzyme complex. The protein localizes to the inner mitochondrial membrane as part of the 7 component-containing, water soluble "iron-sulfur protein" (IP) fraction of complex I, although its specific role is unknown. It is assumed to undergo post-translational removal of the initiator methionine and N-acetylation of the next amino acid. The predicted secondary structure is primarily alpha helix, but the carboxy-terminal half of the protein has high potential to adopt a coiled-coil form. The amino-terminal part contains a putative beta sheet rich in hydrophobic amino acids that may serve as mitochondrial import signal. Related pseudogenes have also been identified on four other chromosomes. [provided by RefSeq
Other Designations
Complex I-13KD-B|NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5|NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5 (13kD, B13)|type I dehydrogenase|ubiquinone reductase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com