NDUFA4 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human NDUFA4 full-length ORF ( NP_002480.1, 1 a.a. - 81 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.8
Interspecies Antigen Sequence
Mouse (88); Rat (88)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — NDUFA4
Entrez GeneID
4697GeneBank Accession#
NM_002489.2Protein Accession#
NP_002480.1Gene Name
NDUFA4
Gene Alias
CI-MLRQ, FLJ27440, MGC104422, MGC126843, MGC126845, MLRQ
Gene Description
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa
Omim ID
603833Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the complex I 9kDa subunit family. Mammalian complex I of mitochondrial respiratory chain is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq
Other Designations
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4 (9kD, MLRQ)|NADH-ubiquinone oxidoreductase MLRQ subunit
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com