Product Browser

Last updated: 2017/6/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NDUFA4 (Human) Recombinant Protein (P01)

  • Catalog # : H00004697-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NDUFA4 full-length ORF ( NP_002480.1, 1 a.a. - 81 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.8
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004697-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4697
  • Gene Name:
  • NDUFA4
  • Gene Alias:
  • CI-MLRQ,FLJ27440,MGC104422,MGC126843,MGC126845,MLRQ
  • Gene Description:
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa
  • Gene Summary:
  • The protein encoded by this gene belongs to the complex I 9kDa subunit family. Mammalian complex I of mitochondrial respiratory chain is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq
  • Other Designations:
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4 (9kD, MLRQ),NADH-ubiquinone oxidoreductase MLRQ subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook