NDUFA1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human NDUFA1 full-length ORF ( AAH00266, 24 a.a. - 70 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
AYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
30.91
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — NDUFA1
Entrez GeneID
4694GeneBank Accession#
BC000266Protein Accession#
AAH00266Gene Name
NDUFA1
Gene Alias
CI-MWFE, MWFE, ZNF183
Gene Description
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa
Gene Ontology
HyperlinkGene Summary
The human NDUFA1 gene codes for an essential component of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. It has been noted that the N-terminal hydrophobic domain has the potential to be folded into an alpha-helix spanning the inner mitochondrial membrane with a C-terminal hydrophilic domain interacting with globular subunits of complex I. The highly conserved two-domain structure suggests that this feature is critical for the protein function and might act as an anchor for the NADH:ubiquinone oxidoreductase complex at the inner mitochondrial membrane. However, the NDUFA1 peptide is one of about 31 components of the "hydrophobic protein" (HP) fraction of complex I which is involved in proton translocation. Thus the NDUFA1 peptide may also participate in that function. [provided by RefSeq
Other Designations
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1|NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1 (7.5kD, MWFE)|NADH oxidoreductase subunit MWFE|NADH:ubiquinone oxidoreductase (complex 1)|OTTHUMP00000023930|type I dehydrogenase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com