NDN monoclonal antibody (M02), clone 1B3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
NDN monoclonal antibody (M02), clone 1B3 Western Blot analysis of NDN expression in HL-60 ( Cat # L014V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of NDN expression in transfected 293T cell line by NDN monoclonal antibody (M02), clone 1B3.
Lane 1: NDN transfected lysate(36.1 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NDN on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NDN is approximately 0.03ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of NDN over-expressed 293 cell line, cotransfected with NDN Validated Chimera RNAi ( Cat # H00004692-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NDN monoclonal antibody (M02), clone 1B3 (Cat # H00004692-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Immunofluorescence
Immunofluorescence of monoclonal antibody to NDN on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.11 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NDN.
Immunogen
NDN (NP_002478, 222 a.a. ~ 321 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
WKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLARVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSED
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NDN monoclonal antibody (M02), clone 1B3 Western Blot analysis of NDN expression in HL-60 ( Cat # L014V1 ).Western Blot (Transfected lysate)
Western Blot analysis of NDN expression in transfected 293T cell line by NDN monoclonal antibody (M02), clone 1B3.
Lane 1: NDN transfected lysate(36.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NDN on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NDN is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of NDN over-expressed 293 cell line, cotransfected with NDN Validated Chimera RNAi ( Cat # H00004692-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NDN monoclonal antibody (M02), clone 1B3 (Cat # H00004692-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to NDN on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — NDN
Entrez GeneID
4692GeneBank Accession#
NM_002487Protein Accession#
NP_002478Gene Name
NDN
Gene Alias
HsT16328, PWCR
Gene Description
necdin homolog (mouse)
Gene Ontology
HyperlinkGene Summary
This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele. Studies in mouse suggest that the protein encoded by this gene may suppress growth in postmitotic neurons. [provided by RefSeq
Other Designations
OTTHUMP00000159437|necdin
-
Interactome
-
Disease
-
Publication Reference
-
Notch3 protein expression in skin fibroblasts from CADASIL patients.
Qualtieri A, Ungaro C, Bagalà A, Bianchi S, Pantoni L, Moccia M, Mazzei R.
Journal of the Neurological Sciences 2018 Jul; 390:121.
Application：IF, Human, Skin fibroblasts.
-
Necdin enhances myoblasts survival by facilitating the degradation of the mediator of apoptosis CCAR1/CARP1.
François S, D'Orlando C, Fatone T, Touvier T, Pessina P, Meneveri R, Brunelli S.
PLoS One 2012 Aug; 7(8):e43335.
Application：WB-Tr, Mouse, C2C12 cells.
-
Notch3 protein expression in skin fibroblasts from CADASIL patients.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com