NUBP1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
NUBP1 MaxPab polyclonal antibody. Western Blot analysis of NUBP1 expression in COLO 320 HSR.
Western Blot (Transfected lysate)
Western Blot analysis of NUBP1 expression in transfected 293T cell line (H00004682-T01) by NUBP1 MaxPab polyclonal antibody.
Lane 1: NUBP1 transfected lysate(35.2 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to NUBP1 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human NUBP1 protein.
Immunogen
NUBP1 (NP_002475.2, 1 a.a. ~ 320 a.a) full-length human protein.
Sequence
MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKMKTVKHKILVLSGKGGVGKSTFSAHLAHGLAEDENTQIALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPVYVEDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (88)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NUBP1 MaxPab polyclonal antibody. Western Blot analysis of NUBP1 expression in COLO 320 HSR.Western Blot (Transfected lysate)
Western Blot analysis of NUBP1 expression in transfected 293T cell line (H00004682-T01) by NUBP1 MaxPab polyclonal antibody.
Lane 1: NUBP1 transfected lysate(35.2 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to NUBP1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — NUBP1
Entrez GeneID
4682GeneBank Accession#
NM_002484.1Protein Accession#
NP_002475.2Gene Name
NUBP1
Gene Alias
MGC117406, MGC130052, MGC130053, NBP, NBP1
Gene Description
nucleotide binding protein 1 (MinD homolog, E. coli)
Omim ID
600280Gene Ontology
HyperlinkGene Summary
NUBP1 is a member of the NUBP/MRP subfamily of ATP-binding proteins (Nakashima et al., 1999 [PubMed 10486206]).[supplied by OMIM
Other Designations
nucleotide binding protein (e.coli MinD like)|nucleotide binding protein 1|nucleotide binding protein 1 (E.coli MinD like)
-
Interactome
-
Disease
-
Publication Reference
-
IOP1 is an external component of human CIA machinery and functions in MMS19-dependent CIA pathway.
Seki M, Takeda Y, Iwai K, Tanaka K.
The Journal of Biological Chemistry 2013 Jun; 288(23):16680.
Application：WB-Tr, Human, HEK 293 cells.
-
IOP1 is an external component of human CIA machinery and functions in MMS19-dependent CIA pathway.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com