NBL1 monoclonal antibody (M01), clone 2G4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
NBL1 monoclonal antibody (M01), clone 2G4 Western Blot analysis of NBL1 expression in A-431 ( Cat # L015V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NBL1 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NBL1.
Immunogen
NBL1 (NP_005371, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
INKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEG
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NBL1 monoclonal antibody (M01), clone 2G4 Western Blot analysis of NBL1 expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NBL1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — NBL1
Entrez GeneID
4681GeneBank Accession#
NM_005380Protein Accession#
NP_005371Gene Name
NBL1
Gene Alias
D1S1733E, DAN, DAND1, MGC8972, NB, NO3
Gene Description
neuroblastoma, suppression of tumorigenicity 1
Omim ID
600613Gene Ontology
HyperlinkGene Summary
This gene product is the founding member of the evolutionarily conserved CAN (Cerberus and DAN) family of proteins, which contain a domain resembling the CTCK (C-terminal cystine knot-like) motif found in a number of signaling molecules. These proteins are secreted, and act as BMP (bone morphogenetic protein) antagonists by binding to BMPs and preventing them from interacting with their receptors. They may thus play an important role during growth and development. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
differential screening-selected gene aberrant in neuroblastoma|neuroblastoma candidate region, suppression of tumorigenicity 1|neuroblastoma suppressor of tumorigenicity 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com