NARS MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
NARS MaxPab rabbit polyclonal antibody. Western Blot analysis of NARS expression in human liver.
Western Blot (Tissue lysate)
NARS MaxPab rabbit polyclonal antibody. Western Blot analysis of NARS expression in mouse spleen.
Western Blot (Cell lysate)
NARS MaxPab rabbit polyclonal antibody. Western Blot analysis of NARS expression in HeLa.
Western Blot (Transfected lysate)
Western Blot analysis of NARS expression in transfected 293T cell line (H00004677-T01) by NARS MaxPab polyclonal antibody.
Lane 1: NARS transfected lysate(62.90 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of NARS transfected lysate using anti-NARS MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with NARS purified MaxPab mouse polyclonal antibody (B01P) (H00004677-B01P).
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to NARS on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human NARS protein.
Immunogen
NARS (NP_004530.1, 1 a.a. ~ 548 a.a) full-length human protein.
Sequence
MVLAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKNIKKMWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Rat (93)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
NARS MaxPab rabbit polyclonal antibody. Western Blot analysis of NARS expression in human liver.Western Blot (Tissue lysate)
NARS MaxPab rabbit polyclonal antibody. Western Blot analysis of NARS expression in mouse spleen.Western Blot (Cell lysate)
NARS MaxPab rabbit polyclonal antibody. Western Blot analysis of NARS expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of NARS expression in transfected 293T cell line (H00004677-T01) by NARS MaxPab polyclonal antibody.
Lane 1: NARS transfected lysate(62.90 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of NARS transfected lysate using anti-NARS MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with NARS purified MaxPab mouse polyclonal antibody (B01P) (H00004677-B01P).Immunofluorescence
Immunofluorescence of purified MaxPab antibody to NARS on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — NARS
Entrez GeneID
4677GeneBank Accession#
NM_004539.2Protein Accession#
NP_004530.1Gene Name
NARS
Gene Alias
ASNRS, NARS1
Gene Description
asparaginyl-tRNA synthetase
Omim ID
108410Gene Ontology
HyperlinkGene Summary
Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Asparaginyl-tRNA synthetase is localized to the cytoplasm and belongs to the class II family of tRNA synthetases. The N-terminal domain represents the signature sequence for the eukaryotic asparaginyl-tRNA synthetases. [provided by RefSeq
Other Designations
asparagine tRNA ligase 1, cytoplasmic
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com