Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NAP1L4 polyclonal antibody (A01)

  • Catalog # : H00004676-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant NAP1L4.
  • Immunogen:
  • NAP1L4 (NP_005960, 1 a.a. ~ 82 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MADHSFSDGVPSDSVEAAKNASNTEKLTDQVMQNPRVLAALQERLDNVPHTPSSYIETLPKAVKRRINALKQLQVRCAHIEA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004676-A01
    Western Blot detection against Immunogen (35.13 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4676
  • Gene Name:
  • NAP1L4
  • Gene Alias:
  • MGC4565,NAP2,NAP2L,hNAP2
  • Gene Description:
  • nucleosome assembly protein 1-like 4
  • Gene Summary:
  • This gene encodes a member of the nucleosome assembly protein (NAP) family which can interact with both core and linker histones. It can shuttle between the cytoplasm and nucleus, suggesting a role as a histone chaperone. This gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000012671,nucleosome assembly protein 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook