Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BIRC1 polyclonal antibody (A01)

  • Catalog # : H00004671-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant BIRC1.
  • Immunogen:
  • BIRC1 (NP_004527, 1294 a.a. ~ 1403 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LENLKLSINHKITEEGYRNFFQALDNMPNLQELDISRHFTECIKAQATTVKSLSQCVLRLPRLIRLNMLSWLLDADDIALLNVMKERHPQSKYLTILQKWILPFSPIIQK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4671
  • Gene Name:
  • NAIP
  • Gene Alias:
  • BIRC1,FLJ18088,FLJ42520,FLJ58811,NLRB1,psiNAIP
  • Gene Description:
  • NLR family, apoptosis inhibitory protein
  • Gene Summary:
  • This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. This copy of the gene is full length; additional copies with truncations and internal deletions are also present in this region of chromosome 5q13. It is thought that this gene is a modifier of spinal muscular atrophy caused by mutations in a neighboring gene, SMN1. The protein encoded by this gene contains regions of homology to two baculovirus inhibitor of apoptosis proteins, and it is able to suppress apoptosis induced by various signals. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • NLR family, BIR domain containing 1,OTTHUMP00000125255,baculoviral IAP repeat-containing 1,neuronal apoptosis inhibitory protein,nucleotide-binding oligomerization domain, leucine rich repeat and BIR domain containing 1,psi neuronal apoptosis inhibitory p
  • RSS
  • YouTube
  • Linkedin
  • Facebook