HNRPM monoclonal antibody (M03), clone 3F7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HNRPM.
Immunogen
HNRPM (NP_005959, 17 a.a. ~ 112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFEPYANPTKRYRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSR
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.3 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HNRPM monoclonal antibody (M03), clone 3F7 Western Blot analysis of HNRPM expression in HepG2 ( Cat # L019V1 ).Western Blot (Cell lysate)
HNRPM monoclonal antibody (M03), clone 3F7. Western Blot analysis of HNRPM expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
HNRPM monoclonal antibody (M03), clone 3F7. Western Blot analysis of HNRNPM expression in A-431.Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HNRPM on formalin-fixed paraffin-embedded human thyroid nodular goiter. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HNRPM is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to HNRPM on HepG2 cell. [antibody concentration 10 ug/ml] -
Gene Info — HNRNPM
Entrez GeneID
4670GeneBank Accession#
NM_005968Protein Accession#
NP_005959Gene Name
HNRNPM
Gene Alias
DKFZp547H118, HNRNPM4, HNRPM, HNRPM4, HTGR1, NAGR1
Gene Description
heterogeneous nuclear ribonucleoprotein M
Omim ID
160994Gene Ontology
HyperlinkGene Summary
This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNAs. This protein also constitutes a monomer of the N-acetylglucosamine-specific receptor which is postulated to trigger selective recycling of immature GlcNAc-bearing thyroglobulin molecules. Multiple alternatively spliced transcript variants are known for this gene but only two transcripts has been isolated. [provided by RefSeq
Other Designations
M4 protein|N-acetylglucosamine receptor 1|heterogenous nuclear ribonucleoprotein M|heterogenous nuclear ribonucleoprotein M4|hnRNA-binding protein M4
-
Interactome
-
Publication Reference
-
hnRNPM, a potential mediator of YY1 in promoting the epithelial-mesenchymal transition of prostate cancer cells.
Yang T, An Z, Zhang C, Wang Z, Wang X, Liu Y, Du E, Liu R, Zhang Z, Xu Y.
Prostate 2019 Aug; 79(11):1199.
Application:IHC-P, WB-Ce, WB-Ti, Human, C4-2, DU 145, H660, LNCaP, PC-3 cells, Prostate cancer.
-
Network Clustering Revealed the Systemic Alterations of Mitochondrial Protein Expression.
Jeon J, Jeong JH, Baek JH, Koo HJ, Park WH, Yang JS, Yu MH, Kim S, Pak YK.
PLoS Computational Biology 2011 Jun; 7(6):e1002093.
Application:WB-Ce, Human, 143B TK- osteosarcoma cells.
-
hnRNPM, a potential mediator of YY1 in promoting the epithelial-mesenchymal transition of prostate cancer cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com