Product Browser

Last updated: 2017/1/22
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NAB2 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00004665-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human NAB2 protein.
  • Immunogen:
  • NAB2 (AAH07756.1, 1 a.a. ~ 241 a.a) full-length human protein.
  • Sequence:
  • MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGEEEAGSRWDWGWSRPTGARDGTPACLGRVWMDICRLWGHVQG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NAB2 expression in transfected 293T cell line (H00004665-T01) by NAB2 MaxPab polyclonal antibody.

    Lane 1: NAB2 transfected lysate(26.51 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4665
  • Gene Name:
  • NAB2
  • Gene Alias:
  • MADER,MGC75085
  • Gene Description:
  • NGFI-A binding protein 2 (EGR1 binding protein 2)
  • Gene Summary:
  • This gene encodes a member of the family of NGFI-A binding (NAB) proteins, which function in the nucleus to repress transcription induced by some members of the EGR (early growth response) family of transactivators. NAB proteins can homo- or hetero-multimerize with other EGR or NAB proteins through a conserved N-terminal domain, and repress transcription through two partially redundant C-terminal domains. Transcriptional repression by the encoded protein is mediated in part by interactions with the nucleosome remodeling and deactylase (NuRD) complex. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq
  • Other Designations:
  • EGR1 binding protein 2,NGFI-A binding protein 2,melanoma-associated delayed early response protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook