MYOG purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
MYOG MaxPab rabbit polyclonal antibody. Western Blot analysis of MYOG expression in mouse lung.
Western Blot (Transfected lysate)
Western Blot analysis of MYOG expression in transfected 293T cell line (H00004656-T02) by MYOG MaxPab polyclonal antibody.
Lane 1: MYOG transfected lysate(25.00 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human MYOG protein.
Immunogen
MYOG (NP_002470.2, 1 a.a. ~ 224 a.a) full-length human protein.
Sequence
MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
MYOG MaxPab rabbit polyclonal antibody. Western Blot analysis of MYOG expression in mouse lung.Western Blot (Transfected lysate)
Western Blot analysis of MYOG expression in transfected 293T cell line (H00004656-T02) by MYOG MaxPab polyclonal antibody.
Lane 1: MYOG transfected lysate(25.00 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MYOG
Entrez GeneID
4656GeneBank Accession#
NM_002479.3Protein Accession#
NP_002470.2Gene Name
MYOG
Gene Alias
MYF4, MYOGENIN, bHLHc3
Gene Description
myogenin (myogenic factor 4)
Omim ID
159980Gene Ontology
HyperlinkGene Summary
Myogenin is a muscle-specific transcription factor that can induce myogenesis in a variety of cell types in tissue culture. It is a member of a large family of proteins related by sequence homology, the helix-loop-helix (HLH) proteins. It is essential for the development of functional skeletal muscle. [provided by RefSeq
Other Designations
Myogenic factor-4; myogenin|OTTHUMP00000039094|myogenic factor 4|myogenin
-
Interactome
-
Publication Reference
-
Large-scale spontaneous self-organization and maturation of skeletal muscle tissues on ultra-compliant gelatin hydrogel substrates.
Joen H Jensen, Selgin D Cakal, Jingwen Li, Christian J Pless, Carmen Radeke, Morten Leth Jepsen, Thomas E Jensen, Martin Dufva, Johan U Lind.
Scientific Reports 2020 Aug; 10(1):13305.
Application：WB-Ce, Mouse, C2C12 cells.
-
Large-scale spontaneous self-organization and maturation of skeletal muscle tissues on ultra-compliant gelatin hydrogel substrates.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com