MYO5A (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human MYO5A partial ORF ( NP_000250.1, 1758 a.a. - 1853 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
KKTDDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQMRLRDRKDSPQLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLGFIS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.3
Interspecies Antigen Sequence
Mouse (94%); Rat (95%)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — MYO5A
Entrez GeneID
4644GeneBank Accession#
NM_000259Protein Accession#
NP_000250.1Gene Name
MYO5A
Gene Alias
GS1, MYH12, MYO5, MYR12
Gene Description
myosin VA (heavy chain 12, myoxin)
Gene Ontology
HyperlinkGene Summary
This gene is one of three myosin V heavy-chain genes, belonging to the myosin gene superfamily. Myosin V is a class of actin-based motor proteins involved in cytoplasmic vesicle transport and anchorage, spindle-pole alignment and mRNA translocation. The protein encoded by this gene is abundant in melanocytes and nerve cells. Mutations in this gene cause Griscelli syndrome type-1 (GS1), Griscelli syndrome type-3 (GS3) and neuroectodermal melanolysosomal disease, or Elejalde disease. Multiple alternatively spliced transcript variants encoding different isoforms have been reported, but the full-length nature of some variants has not been determined. [provided by RefSeq
Other Designations
OTTHUMP00000174452|dilute|myosin V|myosin VA|myosin heavy chain 12|myosin, heavy polypeptide kinase|myoxin
-
Interactome
-
Disease
-
Publication Reference
-
Myosin 5a regulates tumor migration and epithelial-mesenchymal transition in esophageal squamous cell carcinoma: utility as a prognostic factor.
Sato N, Fujishima F, Nakamura Y, Aoyama Y, Onodera Y, Ozawa Y, Ito K, Ishida H, Kamei T, Watanabe M, Sasano H.
Human Pathology 2018 Jun; [Epub].
Application:Func, Antibody.
-
Myosin 5a regulates tumor migration and epithelial-mesenchymal transition in esophageal squamous cell carcinoma: utility as a prognostic factor.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com