Product Browser

Last updated: 2017/9/24
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MYL6 polyclonal antibody (A01)

  • Catalog # : H00004637-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MYL6.
  • Immunogen:
  • MYL6 (NP_066299, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004637-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4637
  • Gene Name:
  • MYL6
  • Gene Alias:
  • ESMLC,LC17-GI,LC17-NM,LC17A,LC17B,MLC1SM,MLC3NM,MLC3SM
  • Gene Description:
  • myosin, light chain 6, alkali, smooth muscle and non-muscle
  • Gene Summary:
  • Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • myosin, light polypeptide 6, alkali, smooth muscle and non-muscle,smooth muscle and non-muscle myosin alkali light chain
  • RSS
  • YouTube
  • Linkedin
  • Facebook