Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MYL5 (Human) Recombinant Protein (Q01)

  • Catalog # : H00004636-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MYL5 partial ORF ( NP_002468, 4 a.a. - 96 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • RKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.97
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004636-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4636
  • Gene Name:
  • MYL5
  • Gene Alias:
  • -
  • Gene Description:
  • myosin, light chain 5, regulatory
  • Gene Summary:
  • This gene encodes one of the myosin light chains, a component of the hexameric ATPase cellular motor protein myosin. Myosin is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene product, one of the regulatory light chains, is expressed in fetal muscle and in adult retina, cerebellum, and basal ganglia. [provided by RefSeq
  • Other Designations:
  • myosin regulatory light chain 5,myosin, light polypeptide 5, regulatory,superfast myosin regulatory light chain 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook