Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MYL2 (Human) Recombinant Protein (P01)

  • Catalog # : H00004633-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MYL2 full-length ORF ( AAH15821.1, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 44.00
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004633-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4633
  • Gene Name:
  • MYL2
  • Gene Alias:
  • CMH10,DKFZp779C0562,MLC2
  • Gene Description:
  • myosin, light chain 2, regulatory, cardiac, slow
  • Gene Summary:
  • Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq
  • Other Designations:
  • RLC of myosin,cardiac ventricular myosin light chain 2,myosin light chain 2,myosin regulatory light chain 2, ventricular/cardiac muscle isoform,myosin, light polypeptide 2, regulatory, cardiac, slow,regulatory light chain of myosin,slow cardiac myosin reg
  • RSS
  • YouTube
  • Linkedin
  • Facebook