MYL1 monoclonal antibody (M01), clone 2D9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MYL1.
Immunogen
MYL1 (NP_524146, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNK
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.54 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MYL1 expression in transfected 293T cell line by MYL1 monoclonal antibody (M01), clone 2D9.
Lane 1: MYL1 transfected lysate(21.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MYL1 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MYL1 is approximately 3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of MYL1 over-expressed 293 cell line, cotransfected with MYL1 Validated Chimera RNAi ( Cat # H00004632-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MYL1 monoclonal antibody (M01), clone 2D9 (Cat # H00004632-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — MYL1
Entrez GeneID
4632GeneBank Accession#
NM_079422Protein Accession#
NP_524146Gene Name
MYL1
Gene Alias
MLC1F, MLC3F
Gene Description
myosin, light chain 1, alkali; skeletal, fast
Omim ID
160780Gene Ontology
HyperlinkGene Summary
Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene. [provided by RefSeq
Other Designations
A1 catalytic|A2 catalytic|OTTHUMP00000163942|fast skeletal myosin alkali light chain 1|myosin, light polypeptide 1, alkali; skeletal, fast
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com