Product Browser

Last updated: 2017/10/15
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MYL1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00004632-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human MYL1 protein.
  • Immunogen:
  • MYL1 (NP_524144.1, 1 a.a. ~ 194 a.a) full-length human protein.
  • Sequence:
  • MAPKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQDEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of MYL1 expression in transfected 293T cell line (H00004632-T01) by MYL1 MaxPab polyclonal antibody.

    Lane 1: MYL1 transfected lysate(21.34 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4632
  • Gene Name:
  • MYL1
  • Gene Alias:
  • MLC1F,MLC3F
  • Gene Description:
  • myosin, light chain 1, alkali; skeletal, fast
  • Gene Summary:
  • Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • A1 catalytic,A2 catalytic,OTTHUMP00000163942,fast skeletal myosin alkali light chain 1,myosin, light polypeptide 1, alkali; skeletal, fast
  • RSS
  • YouTube
  • Linkedin
  • Facebook