Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MYL1 polyclonal antibody (A01)

  • Catalog # : H00004632-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MYL1.
  • Immunogen:
  • MYL1 (NP_524146, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004632-A01
    Western Blot detection against Immunogen (34.91 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4632
  • Gene Name:
  • MYL1
  • Gene Alias:
  • MLC1F,MLC3F
  • Gene Description:
  • myosin, light chain 1, alkali; skeletal, fast
  • Gene Summary:
  • Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • A1 catalytic,A2 catalytic,OTTHUMP00000163942,fast skeletal myosin alkali light chain 1,myosin, light polypeptide 1, alkali; skeletal, fast
  • RSS
  • YouTube
  • Linkedin
  • Facebook