MYL1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant MYL1.
Immunogen
MYL1 (NP_524146, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag.
Sequence
MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNK
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.91 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — MYL1
Entrez GeneID
4632GeneBank Accession#
NM_079422Protein Accession#
NP_524146Gene Name
MYL1
Gene Alias
MLC1F, MLC3F
Gene Description
myosin, light chain 1, alkali; skeletal, fast
Omim ID
160780Gene Ontology
HyperlinkGene Summary
Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene. [provided by RefSeq
Other Designations
A1 catalytic|A2 catalytic|OTTHUMP00000163942|fast skeletal myosin alkali light chain 1|myosin, light polypeptide 1, alkali; skeletal, fast
-
Interactome
-
Publication Reference
-
Protein Array-Based Approach to Evaluate Biomarkers of Beef Tenderness and Marbling in Cows: Understanding of the Underlying Mechanisms and Prediction.
Mohammed Gagaoua, Muriel Bonnet, Brigitte Picard.
Foods (Basel, Switzerland) 2020 Aug; 9(9):E1180.
Application:Reverse Phase Protein Array (RPPA), Human, Human muscle protein.
-
Beef tenderness and intramuscular fat proteomic biomarkers: Effect of gender and rearing practices.
Picard B, Gagaoua M, Al Jammas M, Bonnet M.
Journal of Proteomics 2019 Mar; 200:1.
Application:WB-Ti, Bovine, Bovine muscle.
-
Reverse Phase Protein array for the quantification and validation of protein biomarkers of beef qualities: The case of meat color from Charolais breed.
Gagaoua M, Bonnet M, De Koning L, Picard B.
Meat Science 2018 Jul; 145:308.
Application:WB-Ti, Bovine, Bovine muscle.
-
Beef tenderness and intramuscular fat proteomic biomarkers: muscle type effect.
Picard B, Gagaoua M, Al-Jammas M, De Koning L, Valais A, Bonnet M.
PeerJ 2018 Jun; 6:e4891.
Application:WB-Ti, Bovine, Bovine muscle.
-
Reverse phase protein arrays for the identification/validation of biomarkers of beef texture and their use for early classification of carcasses.
Gagaoua M, Bonnet M, Ellies-Oury MP, De Koning L, Picard B.
Food Chemistry 2018 Jun; 250:245.
Application:WB-Ti, Bovine, Bovine muscles.
-
The study of protein biomarkers to understand the biochemical processes underlying beef color development in young bulls.
Gagaoua M, Terlouw EMC, Picard B.
Meat Science 2017 Jul; 134:18.
Application:Dot, Bovine, Bovine muscle.
-
Inverse relationships between biomarkers and beef tenderness according to contractile and metabolic properties of the muscle.
Picard B, Gagaoua M, Micol D, Cassar-Malek I, Hocquette JF, Terlouw CE.
Journal of Agricultural and Food Chemistry 2014 Oct; 62(40):9808.
Application:Dot, Bovine, Bovine muscle.
-
Functional analysis of beef tenderness.
Guillemin N, Bonnet M, Jurie C, Picard B.
Journal of Proteomics 2011 Dec; 75(2):352.
Application:WB-Ti, Bovine, Bovine tenderness.
-
Protein Array-Based Approach to Evaluate Biomarkers of Beef Tenderness and Marbling in Cows: Understanding of the Underlying Mechanisms and Prediction.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com