Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MYH9 (Human) Recombinant Protein (Q02)

  • Catalog # : H00004627-Q02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MYH9 partial ORF ( NP_002464.1, 1747 a.a. - 1852 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • LINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.4
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004627-Q02
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4627
  • Gene Name:
  • MYH9
  • Gene Alias:
  • DFNA17,EPSTS,FTNS,MGC104539,MHA,NMHC-II-A,NMMHCA
  • Gene Description:
  • myosin, heavy chain 9, non-muscle
  • Gene Summary:
  • This gene encodes a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain. The protein is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in MYH9 are the cause of non-syndromic sensorineural deafness autosomal dominant type 17, Epstein syndrome, Alport syndrome with macrothrombocytopenia, Sebastian syndrome, Fechtner syndrome and macrothrombocytopenia with progressive sensorineural deafness. [provided by RefSeq
  • Other Designations:
  • MYH9 variant protein,OTTHUMP00000028706,cellular myosin heavy chain, type A,myosin, heavy polypeptide 9, non-muscle,non-muscle myosin heavy chain,non-muscle myosin heavy polypeptide 9,nonmuscle myosin heavy chain II-A
  • RSS
  • YouTube
  • Linkedin
  • Facebook