Product Browser

Last updated: 2017/8/13
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MYH7 polyclonal antibody (A01)

  • Catalog # : H00004625-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MYH7.
  • Immunogen:
  • MYH7 (NP_000248, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MGDSEMAVFGAAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKQEFVKAKIVSREGGKVTAETEYGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKDRY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004625-A01
    Western Blot detection against Immunogen (38.1 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4625
  • Gene Name:
  • MYH7
  • Gene Alias:
  • CMD1S,CMH1,DKFZp451F047,MGC138376,MGC138378,MPD1,MYHCB,SPMD,SPMM
  • Gene Description:
  • myosin, heavy chain 7, cardiac muscle, beta
  • Gene Summary:
  • Muscle myosin is a hexameric protein containing 2 heavy chain subunits, 2 alkali light chain subunits, and 2 regulatory light chain subunits. This gene encodes the beta (or slow) heavy chain subunit of cardiac myosin. It is expressed predominantly in normal human ventricle. It is also expressed in skeletal muscle tissues rich in slow-twitch type I muscle fibers. Changes in the relative abundance of this protein and the alpha (or fast) heavy subunit of cardiac myosin correlate with the contractile velocity of cardiac muscle. Its expression is also altered during thyroid hormone depletion and hemodynamic overloading. Mutations in this gene are associated with familial hypertrophic cardiomyopathy, myosin storage myopathy, dilated cardiomyopathy, and Laing early-onset distal myopathy. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000027949,beta-myosin heavy chain,myhc-slow,myopathy, distal 1,myosin heavy chain (AA 1-96),myosin, heavy polypeptide 7, cardiac muscle, beta,rhabdomyosarcoma antigen MU-RMS-40.7A
  • RSS
  • YouTube
  • Linkedin
  • Facebook