MUC7 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human MUC7 partial ORF ( NP_689504, 36 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
HQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — MUC7
Entrez GeneID
4589GeneBank Accession#
NM_152291Protein Accession#
NP_689504Gene Name
MUC7
Gene Alias
DKFZp686J03256, FLJ27047, MG2, MGC34772
Gene Description
mucin 7, secreted
Gene Ontology
HyperlinkGene Summary
This gene encodes a small salivary mucin, which is thought to play a role in facilitating the clearance of bacteria in the oral cavity and to aid in mastication, speech, and swallowing. The central domain of this glycoprotein contains tandem repeats, each composed of 23 amino acids. The most common allele contains 6 repeats, and some alleles may be associated with susceptibility to asthma. Alternatively spliced transcript variants with different 5' UTR, but encoding the same protein, have been found for this gene
Other Designations
mucin 7, salivary
-
Interactome
-
Disease
-
Publication Reference
-
Saliva in Prader-Willi syndrome: quantitative and qualitative characteristics.
Saeves R, Reseland JE, Kvam BM, Sandvik L, Nordgarden H.
Archives of Oral Biology 2012 Oct; 57(10):1335.
Application：Quant, Human, Human saliva.
-
Saliva in Prader-Willi syndrome: quantitative and qualitative characteristics.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com