MUC7 monoclonal antibody (M06), clone 7F2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MUC7.
Immunogen
MUC7 (NP_689504, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQN
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MUC7 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — MUC7
Entrez GeneID
4589GeneBank Accession#
NM_152291Protein Accession#
NP_689504Gene Name
MUC7
Gene Alias
DKFZp686J03256, FLJ27047, MG2, MGC34772
Gene Description
mucin 7, secreted
Gene Ontology
HyperlinkGene Summary
This gene encodes a small salivary mucin, which is thought to play a role in facilitating the clearance of bacteria in the oral cavity and to aid in mastication, speech, and swallowing. The central domain of this glycoprotein contains tandem repeats, each composed of 23 amino acids. The most common allele contains 6 repeats, and some alleles may be associated with susceptibility to asthma. Alternatively spliced transcript variants with different 5' UTR, but encoding the same protein, have been found for this gene
Other Designations
mucin 7, salivary
-
Interactome
-
Disease
-
Publication Reference
-
Aberrant mucin glycoprotein patterns of chronic rhinosinusitis patients with bacterial biofilms.
Tan L, Psaltis A, Baker LM, McGuckin M, Rousseau K, Wormald P.
American Journal of Rhinology & Allergy 2010 Sep; 24(5):319.
Application:Func, Human, Sinonasal.
-
Aberrant mucin glycoprotein patterns of chronic rhinosinusitis patients with bacterial biofilms.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com