MUC1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human MUC1 partial ORF ( NP_877418.1, 315 a.a. - 420 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
NSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDMETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWG
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.4
Interspecies Antigen Sequence
Mouse (88%); Rat (80%)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — MUC1
Entrez GeneID
4582GeneBank Accession#
NM_182741.1Protein Accession#
NP_877418.1Gene Name
MUC1
Gene Alias
CD227, EMA, H23AG, MAM6, PEM, PEMT, PUM
Gene Description
mucin 1, cell surface associated
Omim ID
158340Gene Ontology
HyperlinkGene Summary
This gene is a member of the mucin family and encodes a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas. Multiple alternatively spliced transcript variants that encode different isoforms of this gene have been reported, but the full-length nature of only some has been determined. [provided by RefSeq
Other Designations
DF3 antigen|H23 antigen|MUC-1/SEC|MUC-1/X|MUC1/ZD|OTTHUMP00000033787|OTTHUMP00000033790|OTTHUMP00000033795|breast carcinoma-associated antigen DF3|episialin|mucin 1|mucin 1, transmembrane|peanut-reactive urinary mucin|polymorphic epithelial mucin|tumor as
-
Interactome
-
Disease
-
Publication Reference
-
Sandwich immunoassay coupled with isothermal exponential amplification reaction: An ultrasensitive approach for determination of tumor marker MUC1.
Liu H, Zhang L, Xu Y, Chen J, Wang Y, Huang Q, Chen X, Liu Y, Dai Z, Zou X, Li Z.
Talanta 2019 Nov; 204:248.
Application:Func, Compound.
-
Identification of tumor-reactive B cells and systemic IgG in breast cancer based on clonal frequency in the sentinel lymph node.
McDaniel JR, Pero SC, Voss WN, Shukla GS, Sun Y, Schaetzle S, Lee CH, Horton AP, Harlow S, Gollihar J, Ellefson JW, Krag CC, Tanno Y, Sidiropoulos N, Georgiou G, Ippolito GC, Krag DN.
Cancer Immunology, Immunotherapy : CII 2018 May; 67(5):729.
Application:ELISA, Human, Blood plasma.
-
Evaluation of known oncoantibodies, HER2, p53, and cyclin B1, in prediagnostic breast cancer sera.
Lu H, Ladd J, Feng Z, Wu M, Goodell V, Pitteri SJ, Li CI, Prentice R, Hanash SM, Disis ML.
Cancer Prevention Research (Philadelphia, Pa.) 2012 Aug; 5(8):1036.
Application:ELISA, Human, Serum from patients with breast cancer.
-
Identification of a New Panel of Serum Autoantibodies Associated with the Presence of In situ Carcinoma of the Breast in Younger Women.
Desmetz C, Bascoul-Mollevi C, Rochaix P, Lamy PJ, Kramar A, Rouanet P, Maudelonde T, Mange A, Solassol J.
Clinical Cancer Research 2009 Jul; 15(14):4733.
Application:ELISA, Human, Human serum.
-
Sandwich immunoassay coupled with isothermal exponential amplification reaction: An ultrasensitive approach for determination of tumor marker MUC1.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com