Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MUC1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00004582-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MUC1 partial ORF ( NP_877418.1, 315 a.a. - 420 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • NSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDMETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.4
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004582-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4582
  • Gene Name:
  • MUC1
  • Gene Alias:
  • CD227,EMA,H23AG,MAM6,PEM,PEMT,PUM
  • Gene Description:
  • mucin 1, cell surface associated
  • Gene Summary:
  • This gene is a member of the mucin family and encodes a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas. Multiple alternatively spliced transcript variants that encode different isoforms of this gene have been reported, but the full-length nature of only some has been determined. [provided by RefSeq
  • Other Designations:
  • DF3 antigen,H23 antigen,MUC-1/SEC,MUC-1/X,MUC1/ZD,OTTHUMP00000033787,OTTHUMP00000033790,OTTHUMP00000033795,breast carcinoma-associated antigen DF3,episialin,mucin 1,mucin 1, transmembrane,peanut-reactive urinary mucin,polymorphic epithelial mucin,tumor as
  • RSS
  • YouTube
  • Linkedin
  • Facebook