MTRR monoclonal antibody (M01), clone 1G7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant MTRR.
Immunogen
MTRR (NP_002445, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MRRFLLLYATQQGQAKAIAEEMCEQAVVHGFSADLHCISESDKYDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGLLGLGDSEYTYFCNGGKI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (80)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — MTRR
Entrez GeneID
4552GeneBank Accession#
NM_002454Protein Accession#
NP_002445Gene Name
MTRR
Gene Alias
MGC129643, MSR
Gene Description
5-methyltetrahydrofolate-homocysteine methyltransferase reductase
Gene Ontology
HyperlinkGene Summary
Methionine is an essential amino acid required for protein synthesis and one-carbon metabolism. Its synthesis is catalyzed by the enzyme methionine synthase. Methionine synthase eventually becomes inactive due to the oxidation of its cob(I)alamin cofactor. The protein encoded by this gene regenerates a functional methionine synthase via reductive methylation. It is a member of the ferredoxin-NADP(+) reductase (FNR) family of electron transferases. Patients of the cbl-E complementation group of disorders of folate/cobalamin metabolism are defective in reductive activation of methionine synthase. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq
Other Designations
[methionine synthase]-cobalamin methyltransferase (cob(II)alamin reducing)|methionine synthase reductase
-
Interactomes
-
Diseases
-
Publication Reference
-
Diflavin oxidoreductases activate the bioreductive prodrug PR-104A under hypoxia.
Guise CP, Abbattista MR, Tipparaju SR, Lambie NK, Su J, Li D, Wilson WR, Dachs GU, Patterson AV.
Molecular Pharmacology 2012 Jan; 81(1):31.
Application:WB-Ce, WB-Tr, Human, HCT-8Sa, Panc-01, SiHa, HepG2, H522, H1299, Hep3B, Du145, FaDu, MiaPaca, HT29, HCT116, A549, H460, A431, SKOV-3, H69, 22Rv1, MDA231, C33A, PC3, A2780, H82 cells.
-
Diflavin oxidoreductases activate the bioreductive prodrug PR-104A under hypoxia.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com