MTM1 monoclonal antibody (M01), clone 1C10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of MTM1 expression in transfected 293T cell line by MTM1 monoclonal antibody (M01), clone 1C10.
Lane 1: MTM1 transfected lysate(69.9 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MTM1 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MTM1 is approximately 1ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of MTM1 over-expressed 293 cell line, cotransfected with MTM1 Validated Chimera RNAi ( Cat # H00004534-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MTM1 monoclonal antibody (M01), clone 1C10 (Cat # H00004534-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MTM1.
Immunogen
MTM1 (AAH30779, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MASASTSKYNSHSLENESIKRTSRDGVNRDLTEAVPRLPGETLITDKEVIYICPFNGPIKGRVYITNYRLYLRSLETDSSLILDVPLGVISRIEKMGGAT
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MTM1 expression in transfected 293T cell line by MTM1 monoclonal antibody (M01), clone 1C10.
Lane 1: MTM1 transfected lysate(69.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MTM1 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MTM1 is approximately 1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of MTM1 over-expressed 293 cell line, cotransfected with MTM1 Validated Chimera RNAi ( Cat # H00004534-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MTM1 monoclonal antibody (M01), clone 1C10 (Cat # H00004534-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — MTM1
Entrez GeneID
4534GeneBank Accession#
BC030779Protein Accession#
AAH30779Gene Name
MTM1
Gene Alias
CNM, MTMX, XLMTM
Gene Description
myotubularin 1
Gene Ontology
HyperlinkGene Summary
This gene encodes a dual-specificity phosphatase that acts on both phosphotyrosine and phosphoserine. It is required for muscle cell differentiation and mutations in this gene have been identified as being responsible for X-linked myotubular myopathy. [provided by RefSeq
Other Designations
myotubularin
-
Interactome
-
Disease
-
Publication Reference
-
Novel findings associated with MTM1 suggest a higher number of female symptomatic carriers.
Savarese M, Musumeci O, Giugliano T, Rubegni A, Fiorillo C, Fattori F, Torella A, Battini R, Rodolico C, Pugliese A, Piluso G, Maggi L, DAmico A, Bruno C, Bertini E, Santorelli FM, Mora M, Toscano A, Minetti C, Nigro V.
Neuromuscular Disorders 2016 Apr; 26(4-5):292.
Application：WB-Ti, Human, Skeletal muscles.
-
Myopathy in a woman and her daughter associated with a novel splice site MTM1 mutation.
Hedberg C, Lindberg C, Mathe G, Moslemi AR, Oldfors A.
Neuromuscular Disorders 2012 Mar; 22(3):244.
Application：WB-Ti, Human, Skeletal muscle.
-
Novel findings associated with MTM1 suggest a higher number of female symptomatic carriers.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com