NUDT1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human NUDT1 full-length ORF ( AAH14618, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
45.43
Interspecies Antigen Sequence
Mouse (83); Rat (85)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — NUDT1
Entrez GeneID
4521GeneBank Accession#
BC014618Protein Accession#
AAH14618Gene Name
NUDT1
Gene Alias
MTH1
Gene Description
nudix (nucleoside diphosphate linked moiety X)-type motif 1
Omim ID
600312Gene Ontology
HyperlinkGene Summary
Misincorporation of oxidized nucleoside triphosphates into DNA/RNA during replication and transcription can cause mutations that may result in carcinogenesis or neurodegeneration. The protein encoded by this gene is an enzyme that hydrolyzes oxidized purine nucleoside triphosphates, such as 8-oxo-dGTP, 8-oxo-dATP, 2-hydroxy-dATP, and 2-hydroxy rATP, to monophosphates, thereby preventing misincorporation. The encoded protein is localized mainly in the cytoplasm, with some in the mitochondria, suggesting that it is involved in the sanitization of nucleotide pools both for nuclear and mitochondrial genomes. Several alternatively spliced transcript variants, some of which encode distinct isoforms, have been identified. Additional variants have been observed, but their full-length natures have not been determined. A single-nucleotide polymorphism that results in the production of an additional, longer isoform (p26) has been described. [provided by RefSeq
Other Designations
7,8-dihydro-8-oxoguanine triphosphatase|8-oxo-7,8-dihydrodeoxyguanosine triphosphatase|8-oxo-7,8-dihydroguanosine triphosphatase|8-oxo-dGTPase|OTTHUMP00000024690|OTTHUMP00000115537|OTTHUMP00000115538|OTTHUMP00000115539|OTTHUMP00000115540|mutT human homolo
-
Interactome
-
Disease
-
Publication Reference
-
The nucleotide pool, a target for low-dose gamma-ray-induced oxidative stress.
Sangsuwan T, Haghdoost S.
Radiation Research 2008 Dec; 170(6):776.
Application:WB, Rabbit, Antibody.
-
The nucleotide pool, a target for low-dose gamma-ray-induced oxidative stress.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com