Product Browser

Last updated: 2017/7/16
  • Related Product Showcase
  • By Research Area
  • By Disease
  • By Biomarker
  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Vote for Cancer Research Topics & Genes to Win One Free Antibody
pathway

NUDT1 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00004521-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human NUDT1 protein.
  • Immunogen:
  • NUDT1 (NP_002443.3, 1 a.a. ~ 156 a.a) full-length human protein.
  • Sequence:
  • MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • NUDT1 MaxPab rabbit polyclonal antibody. Western Blot analysis of NUDT1 expression in human kidney.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NUDT1 expression in transfected 293T cell line (H00004521-T01) by NUDT1 MaxPab polyclonal antibody.

    Lane 1: NUDT1 transfected lysate(18 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of NUDT1 transfected lysate using anti-NUDT1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NUDT1 MaxPab mouse polyclonal antibody (B01) (H00004521-B01).
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4521
  • Gene Name:
  • NUDT1
  • Gene Alias:
  • MTH1
  • Gene Description:
  • nudix (nucleoside diphosphate linked moiety X)-type motif 1
  • Gene Summary:
  • Misincorporation of oxidized nucleoside triphosphates into DNA/RNA during replication and transcription can cause mutations that may result in carcinogenesis or neurodegeneration. The protein encoded by this gene is an enzyme that hydrolyzes oxidized purine nucleoside triphosphates, such as 8-oxo-dGTP, 8-oxo-dATP, 2-hydroxy-dATP, and 2-hydroxy rATP, to monophosphates, thereby preventing misincorporation. The encoded protein is localized mainly in the cytoplasm, with some in the mitochondria, suggesting that it is involved in the sanitization of nucleotide pools both for nuclear and mitochondrial genomes. Several alternatively spliced transcript variants, some of which encode distinct isoforms, have been identified. Additional variants have been observed, but their full-length natures have not been determined. A single-nucleotide polymorphism that results in the production of an additional, longer isoform (p26) has been described. [provided by RefSeq
  • Other Designations:
  • 7,8-dihydro-8-oxoguanine triphosphatase,8-oxo-7,8-dihydrodeoxyguanosine triphosphatase,8-oxo-7,8-dihydroguanosine triphosphatase,8-oxo-dGTPase,OTTHUMP00000024690,OTTHUMP00000115537,OTTHUMP00000115538,OTTHUMP00000115539,OTTHUMP00000115540,mutT human homolo
  • RSS
  • YouTube
  • Linkedin
  • Facebook