MTCP1 monoclonal antibody (M05), clone 1G12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of MTCP1 expression in transfected 293T cell line by MTCP1 monoclonal antibody (M05), clone 1G12.
Lane 1: MTCP1 transfected lysate (Predicted MW: 7.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MTCP1 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (33 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant MTCP1.
Immunogen
MTCP1 (AAH02600, 1 a.a. ~ 68 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MTCP1 expression in transfected 293T cell line by MTCP1 monoclonal antibody (M05), clone 1G12.
Lane 1: MTCP1 transfected lysate (Predicted MW: 7.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MTCP1 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — MTCP1
Entrez GeneID
4515GeneBank Accession#
BC002600Protein Accession#
AAH02600Gene Name
MTCP1
Gene Alias
C6.1B, P13MTCP1
Gene Description
mature T-cell proliferation 1
Omim ID
300116Gene Ontology
HyperlinkGene Summary
This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the upstream 13 kDa protein that is a member of the TCL1 family. This protein may be involved in leukemogenesis. [provided by RefSeq
Other Designations
OTTHUMP00000015489|OTTHUMP00000015491|OTTHUMP00000015492|OTTHUMP00000024241|OTTHUMP00000082776
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com