Product Browser

Last updated: 2017/9/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MSRA (Human) Recombinant Protein (P01)

  • Catalog # : H00004482-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MSRA full-length ORF ( NP_036463.1, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 52.5
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004482-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4482
  • Gene Name:
  • MSRA
  • Gene Alias:
  • -
  • Gene Description:
  • methionine sulfoxide reductase A
  • Gene Summary:
  • This protein is ubiquitous and highly conserved. It carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. Its proposed function is the repair of oxidative damage to proteins to restore biological activity. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • cytosolic methionine-S-sulfoxide reductase,peptide met (O) reductase
  • RSS
  • YouTube
  • Linkedin
  • Facebook