MSRA purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
MSRA MaxPab polyclonal antibody. Western Blot analysis of MSRA expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of MSRA expression in transfected 293T cell line (H00004482-T01) by MSRA MaxPab polyclonal antibody.
Lane 1: MSRA transfected lysate(25.85 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human MSRA protein.
Immunogen
MSRA (NP_036463.1, 1 a.a. ~ 235 a.a) full-length human protein.
Sequence
MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
MSRA MaxPab polyclonal antibody. Western Blot analysis of MSRA expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of MSRA expression in transfected 293T cell line (H00004482-T01) by MSRA MaxPab polyclonal antibody.
Lane 1: MSRA transfected lysate(25.85 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MSRA
Entrez GeneID
4482GeneBank Accession#
NM_012331.2Protein Accession#
NP_036463.1Gene Name
MSRA
Gene Alias
-
Gene Description
methionine sulfoxide reductase A
Omim ID
601250Gene Ontology
HyperlinkGene Summary
This protein is ubiquitous and highly conserved. It carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. Its proposed function is the repair of oxidative damage to proteins to restore biological activity. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
cytosolic methionine-S-sulfoxide reductase|peptide met (O) reductase
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com