Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MSMB (Human) Recombinant Protein (P01)

  • Catalog # : H00004477-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MSMB full-length ORF ( AAH05257.1, 1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 38.28
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004477-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4477
  • Gene Name:
  • MSMB
  • Gene Alias:
  • HPC13,IGBF,MSP,MSPB,PN44,PRPS,PSP,PSP-94,PSP57,PSP94
  • Gene Description:
  • microseminoprotein, beta-
  • Gene Summary:
  • The protein encoded by this gene is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in uterine, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer. Two alternatively spliced transcript variants encoding different isoforms are described for this gene. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000019596,OTTHUMP00000019597,beta-microseminoprotein,immunoglobulin binding factor,prostate secreted seminal plasma protein,prostatic secretory protein 94,seminal plasma beta-inhibin
  • RSS
  • YouTube
  • Linkedin
  • Facebook