CITED1 monoclonal antibody (M03), clone 5H6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CITED1 monoclonal antibody (M03), clone 5H6 Western Blot analysis of CITED1 expression in A-431 ( Cat # L015V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of CITED1 expression in transfected 293T cell line by CITED1 monoclonal antibody (M03), clone 5H6.
Lane 1: CITED1 transfected lysate(19.9 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CITED1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.2 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CITED1 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CITED1.
Immunogen
CITED1 (NP_004134, 94 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (72); Rat (77)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CITED1 monoclonal antibody (M03), clone 5H6 Western Blot analysis of CITED1 expression in A-431 ( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of CITED1 expression in transfected 293T cell line by CITED1 monoclonal antibody (M03), clone 5H6.
Lane 1: CITED1 transfected lysate(19.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CITED1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.2 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CITED1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — CITED1
Entrez GeneID
4435GeneBank Accession#
NM_004143Protein Accession#
NP_004134Gene Name
CITED1
Gene Alias
MSG1
Gene Description
Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1
Omim ID
300149Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the CREB-binding protein/p300-interacting transactivator with Asp/Glu-rich C-terminal domain (CITED) family of proteins. The encoded protein, also known as melanocyte-specific gene 1, may function as a transcriptional coactivator and may play a role in pigmentation of melanocytes. Alternatively spliced transcript variants have been described. [provided by RefSeq
Other Designations
Cbp/p300-interacting transactivator 1|OTTHUMP00000023529|OTTHUMP00000023530
-
Interactome
-
Publication Reference
-
Identification and Characterization of the Wilms Tumor Cancer Stem Cell.
Astgik Petrosyan, Valentina Villani, Paola Aguiari, Matthew E. Thornton, Yizhou Wang, Alex Rajewski, Shengmei Zhou, Paolo Cravedi, Brendan H. Grubbs, Roger E. De Filippo, Sargis Sedrakyan, Kevin V. Lemley, Marie Csete, Stefano Da Sacco, Laura Perin.
Advanced Science (Weinheim, Baden-Württemberg, Germany) 2023 Jul; 10(20):e2206787.
Application：IF, Human, Human fetal kidney.
-
Identification and Characterization of the Wilms Tumor Cancer Stem Cell.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com