CITED1 monoclonal antibody (M01), clone 6G8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CITED1.
Immunogen
CITED1 (NP_004134, 94 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (72); Rat (77)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CITED1 monoclonal antibody (M01), clone 6G8. Western Blot analysis of CITED1 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
CITED1 monoclonal antibody (M01), clone 6G8 Western Blot analysis of CITED1 expression in A-431 ( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of CITED1 expression in transfected 293T cell line by CITED1 monoclonal antibody (M01), clone 6G8.
Lane 1: CITED1 transfected lysate(19.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CITED1 is approximately 0.3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of CITED1 over-expressed 293 cell line, cotransfected with CITED1 Validated Chimera RNAi ( Cat # H00004435-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CITED1 monoclonal antibody (M01), clone 6G8 (Cat # H00004435-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — CITED1
Entrez GeneID
4435GeneBank Accession#
NM_004143Protein Accession#
NP_004134Gene Name
CITED1
Gene Alias
MSG1
Gene Description
Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1
Omim ID
300149Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the CREB-binding protein/p300-interacting transactivator with Asp/Glu-rich C-terminal domain (CITED) family of proteins. The encoded protein, also known as melanocyte-specific gene 1, may function as a transcriptional coactivator and may play a role in pigmentation of melanocytes. Alternatively spliced transcript variants have been described. [provided by RefSeq
Other Designations
Cbp/p300-interacting transactivator 1|OTTHUMP00000023529|OTTHUMP00000023530
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com