Product Browser

Last updated: 2017/8/20
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CITED1 polyclonal antibody (A01)

  • Catalog # : H00004435-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant CITED1.
  • Immunogen:
  • CITED1 (AAH04240, 1 a.a. ~ 193 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGAPTSSSGSPIGSPTTTPPTKPPSFNLHPAPHLLASMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4435
  • Gene Name:
  • CITED1
  • Gene Alias:
  • MSG1
  • Gene Description:
  • Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1
  • Gene Summary:
  • This gene encodes a member of the CREB-binding protein/p300-interacting transactivator with Asp/Glu-rich C-terminal domain (CITED) family of proteins. The encoded protein, also known as melanocyte-specific gene 1, may function as a transcriptional coactivator and may play a role in pigmentation of melanocytes. Alternatively spliced transcript variants have been described. [provided by RefSeq
  • Other Designations:
  • Cbp/p300-interacting transactivator 1,OTTHUMP00000023529,OTTHUMP00000023530
  • RSS
  • YouTube
  • Linkedin
  • Facebook