ABCC1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ABCC1 partial ORF ( NP_004987, 816 a.a. - 915 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Interspecies Antigen Sequence
Mouse (76); Rat (76)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ABCC1
Entrez GeneID
4363GeneBank Accession#
NM_004996Protein Accession#
NP_004987Gene Name
ABCC1
Gene Alias
ABC29, ABCC, DKFZp686N04233, DKFZp781G125, GS-X, MRP, MRP1
Gene Description
ATP-binding cassette, sub-family C (CFTR/MRP), member 1
Omim ID
158343Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternative splicing by exon deletion results in several splice variants but maintains the original open reading frame in all forms. [provided by RefSeq
Other Designations
ATP-binding cassette, sub-family C, member 1|LTC4 transporter|OTTHUMP00000045904|leukotriene C(4) transporter|multidrug resistance protein|multiple drug resistance protein 1|multiple drug resistance-associated protein
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com