Product Browser

Last updated: 2017/7/16
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MPV17 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00004358-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human MPV17 protein.
  • Immunogen:
  • MPV17 (NP_002428.1, 1 a.a. ~ 176 a.a) full-length human protein.
  • Sequence:
  • MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCGFVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHRL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of MPV17 expression in transfected 293T cell line (H00004358-T01) by MPV17 MaxPab polyclonal antibody.

    Lane 1: MPV17 transfected lysate(19.36 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4358
  • Gene Name:
  • MPV17
  • Gene Alias:
  • SYM1
  • Gene Description:
  • MpV17 mitochondrial inner membrane protein
  • Gene Summary:
  • This gene encodes a mitochondrial inner membrane protein that is implicated in the metabolism of reactive oxygen species. Mutations in this gene have been associated with the hepatocerebral form of mitochondrial DNA depletion syndrome (MDDS). [provided by RefSeq
  • Other Designations:
  • Mpv17 protein,Mpv17, human homolog of glomerulosclerosis and nephrotic syndrome,OTTHUMP00000122592
  • RSS
  • YouTube
  • Linkedin
  • Facebook