MPST (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human MPST full-length ORF ( NP_066949.1, 1 a.a. - 297 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAFGHHAVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWYMRARPEDVISEGRGKTH
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
59.6
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — MPST
Entrez GeneID
4357GeneBank Accession#
NM_021126.4Protein Accession#
NP_066949.1Gene Name
MPST
Gene Alias
MGC24539, MST, TST2
Gene Description
mercaptopyruvate sulfurtransferase
Omim ID
602496Gene Ontology
HyperlinkGene Summary
This protein encoded by this gene catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cysteine degradation and cyanide detoxification. There is confusion in literature between this protein (mercaptopyruvate sulfurtransferase, MPST), which appears to be cytoplasmic, and thiosulfate sulfurtransferase (rhodanese, TST, GeneID:7263), which is a mitochondrial protein. Deficiency in MPST activity has been implicated in a rare inheritable disorder known as mercaptolactate-cysteine disulfiduria (MCDU). Alternatively spliced transcript variants encoding same or different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
3-mercaptopyruvate sulfurtransferase|OTTHUMP00000028670|human liver rhodanese
-
Interactome
-
Pathway
-
Publication Reference
-
Endogenously produced hydrogen sulfide is involved in porcine oocyte maturation in vitro.
Nevoral J, Zalmanova T, Zamostna K, Kott T, Kucerova-Chrpova V, Bodart JF, Gelaude A, Prochazka R, Orsak M, Sulc M, Klein P, Dvorakova M, Weingartova I, Vighova A, Hoskova K, Krejcova T, Jilek F, Petr J.
Nitric Oxide 2015 Dec; 51:24.
Application:IF, WB, Porcine, Oocytes.
-
Endogenously produced hydrogen sulfide is involved in porcine oocyte maturation in vitro.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com