MPST purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human MPST protein.
Immunogen
MPST (NP_066949.1, 1 a.a. ~ 297 a.a) full-length human protein.
Sequence
MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAFGHHAVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWYMRARPEDVISEGRGKTH
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
MPST MaxPab rabbit polyclonal antibody. Western Blot analysis of MPST expression in mouse testis.Western Blot (Transfected lysate)
Western Blot analysis of MPST expression in transfected 293T cell line (H00004357-T02) by MPST MaxPab polyclonal antibody.
Lane 1: MPST transfected lysate(33.20 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MPST
Entrez GeneID
4357GeneBank Accession#
NM_021126.4Protein Accession#
NP_066949.1Gene Name
MPST
Gene Alias
MGC24539, MST, TST2
Gene Description
mercaptopyruvate sulfurtransferase
Omim ID
602496Gene Ontology
HyperlinkGene Summary
This protein encoded by this gene catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cysteine degradation and cyanide detoxification. There is confusion in literature between this protein (mercaptopyruvate sulfurtransferase, MPST), which appears to be cytoplasmic, and thiosulfate sulfurtransferase (rhodanese, TST, GeneID:7263), which is a mitochondrial protein. Deficiency in MPST activity has been implicated in a rare inheritable disorder known as mercaptolactate-cysteine disulfiduria (MCDU). Alternatively spliced transcript variants encoding same or different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
3-mercaptopyruvate sulfurtransferase|OTTHUMP00000028670|human liver rhodanese
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com