MPP2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human MPP2 partial ORF ( NP_005365.3, 72 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
QEILRDLAHVAEQSSTAAELAHILQEPHFQSLLETHDSVASKTYETPPPSPGLDPTFSNQPVPPDAVRMVGIRKTAGEHLGVTFRVEGGELVIA
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.08
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — MPP2
Entrez GeneID
4355GeneBank Accession#
NM_005374Protein Accession#
NP_005365.3Gene Name
MPP2
Gene Alias
DKFZp686A06252, DKFZp686J2189, DKFZp761D0712, DLG2
Gene Description
membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2)
Omim ID
600723Gene Ontology
HyperlinkGene Summary
Palmitoylated membrane protein 2 is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions. Palmitoylated membrane protein 2 contains a conserved sequence, called the SH3 (src homology 3) motif, found in several other proteins that associate with the cytoskeleton and are suspected to play important roles in signal transduction. [provided by RefSeq
Other Designations
MAGUK p55 subfamily member 2|discs large, homolog 2|palmitoylated membrane protein 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com