Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MOCS2 (Human) Recombinant Protein (P01)

  • Catalog # : H00004338-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MOCS2 full-length ORF ( NP_789776.1, 1 a.a. - 88 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MVPLCQVEVLYFAKSAEITGVRSETISVPQEIKALQLWKEIETRHPGLADVRNQIIFAVRQEYVELGDQLLVLQPGDEIAVIPPISGG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.2
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004338-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4338
  • Gene Name:
  • MOCS2
  • Gene Alias:
  • MCBPE,MOCO1,MOCS2A,MOCS2B,MPTS
  • Gene Description:
  • molybdenum cofactor synthesis 2
  • Gene Summary:
  • Eukaryotic molybdoenzymes use a unique molybdenum cofactor (MoCo) consisting of a pterin, termed molybdopterin, and the catalytically active metal molybdenum. MoCo is synthesized from precursor Z by the heterodimeric enzyme molybdopterin synthase. The large and small subunits of molybdopterin synthase are both encoded from this gene by overlapping open reading frames. The proteins were initially thought to be encoded from a bicistronic transcript. They are now thought to be encoded from monocistronic transcripts. Alternatively spliced transcripts have been found for this locus that encode the large and small subunits. [provided by RefSeq
  • Other Designations:
  • MPT synthase,OTTHUMP00000122459,molybdenum cofactor biosynthesis protein E,molybdopterin synthase
  • RSS
  • YouTube
  • Linkedin
  • Facebook