Product Browser

Last updated: 2017/10/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MN1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00004330-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MN1 partial ORF ( NP_002421, 1212 a.a. - 1320 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • STIDLDSLMAEHSAAWYMPADKALVDSADDDKTLAPWEKAKPQNPNSKEAHDLPANKASASQPGSHLQCLSVHCTDDVGDAKARASVPTWRSLHSDISNRFGTFVAALT
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.73
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004330-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4330
  • Gene Name:
  • MN1
  • Gene Alias:
  • MGCR,MGCR1,MGCR1-PEN,dJ353E16.2
  • Gene Description:
  • meningioma (disrupted in balanced translocation) 1
  • Gene Summary:
  • Meningioma 1 (MN1) contains two sets of CAG repeats. It is disrupted by a balanced translocation (4;22) in a meningioma, and its inactivation may contribute to meningioma 32 pathogenesis. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000028743,bK437G10B.1 (meningioma (disrupted in balanced translocation) 1),meningioma 1,meningioma (translocation balanced),meningioma chromosome region 1,probable tumor suppressor protein MN1
  • RSS
  • YouTube
  • Linkedin
  • Facebook