MMP19 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
MMP19 MaxPab polyclonal antibody. Western Blot analysis of MMP19 expression in HeLa.
Western Blot (Transfected lysate)
Western Blot analysis of MMP19 expression in transfected 293T cell line (H00004327-T01) by MMP19 MaxPab polyclonal antibody.
Lane 1: MMP19 transfected lysate(55.88 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human MMP19 protein.
Immunogen
MMP19 (NP_002420.1, 1 a.a. ~ 508 a.a) full-length human protein.
Sequence
MNCQQLWLGFLLPMTVSGRVLGLAEVAPVDYLSQYGYLQKPLEGSNNFKPEDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNLPSTLPPHTARAALRQAFQDWSNVAPLTFQEVQAGAADIRLSFHGRQSSYCSNTFDGPGRVLAHADIPELGSVHFDEDEFWTEGTYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGYRPHFKLHPDDVAGIQALYGKKSPVIRDEEEEETELPTVPPVPTEPSPMPDPCSSELDAMMLGPRGKTYAFKGDYVWTVSDSGPGPLFRVSALWEGLPGNLDAAVYSPRTQWIHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSSYPKPIKGLFTGVPNQPSAAMSWQDGRVYFFKGKVYWRLNQQLRVEKGYPRNISHNWMHCRPRTIDTTPSGGNTTPSGTGITLDTTLSATETTFEY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (79); Rat (81)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MMP19 MaxPab polyclonal antibody. Western Blot analysis of MMP19 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of MMP19 expression in transfected 293T cell line (H00004327-T01) by MMP19 MaxPab polyclonal antibody.
Lane 1: MMP19 transfected lysate(55.88 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MMP19
Entrez GeneID
4327GeneBank Accession#
NM_002429.4Protein Accession#
NP_002420.1Gene Name
MMP19
Gene Alias
MMP18, RASI-1
Gene Description
matrix metallopeptidase 19
Omim ID
601807Gene Ontology
HyperlinkGene Summary
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This protein is expressed in human epidermis and it has a role in cellular proliferation as well as migration and adhesion to type I collagen. Multiple transcript variants encoding distict isoforms have been identified for this gene. [provided by RefSeq
Other Designations
matrix metalloproteinase 18|matrix metalloproteinase 19
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com