MMP13 monoclonal antibody (M07), clone 3B11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of MMP13 expression in transfected 293T cell line by MMP13 monoclonal antibody (M07), clone 3B11.
Lane 1: MMP13 transfected lysate(53.8 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of MMP13 transfected lysate using anti-MMP13 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MMP13 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MMP13 is approximately 1ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of MMP13 over-expressed 293 cell line, cotransfected with MMP13 Validated Chimera RNAi ( Cat # H00004322-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MMP13 monoclonal antibody (M07), clone 3B11 (Cat # H00004322-M07 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MMP13.
Immunogen
MMP13 (NP_002418, 362 a.a. ~ 471 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (86)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MMP13 expression in transfected 293T cell line by MMP13 monoclonal antibody (M07), clone 3B11.
Lane 1: MMP13 transfected lysate(53.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of MMP13 transfected lysate using anti-MMP13 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MMP13 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MMP13 is approximately 1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of MMP13 over-expressed 293 cell line, cotransfected with MMP13 Validated Chimera RNAi ( Cat # H00004322-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MMP13 monoclonal antibody (M07), clone 3B11 (Cat # H00004322-M07 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — MMP13
Entrez GeneID
4322GeneBank Accession#
NM_002427Protein Accession#
NP_002418Gene Name
MMP13
Gene Alias
CLG3
Gene Description
matrix metallopeptidase 13 (collagenase 3)
Gene Ontology
HyperlinkGene Summary
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The protein encoded by this gene cleaves type II collagen more efficiently than types I and III. It may be involved in articular cartilage turnover and cartilage pathophysiology associated with osteoarthritis. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. [provided by RefSeq
Other Designations
collagenase 3|matrix metalloproteinase 13|matrix metalloproteinase 13 (collagenase 3)
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com