MMP7 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human MMP7 full-length ORF ( NP_002414.1, 1 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
56.1
Interspecies Antigen Sequence
Mouse (70); Rat (70)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — MMP7
Entrez GeneID
4316GeneBank Accession#
NM_002423.3Protein Accession#
NP_002414.1Gene Name
MMP7
Gene Alias
MMP-7, MPSL1, PUMP-1
Gene Description
matrix metallopeptidase 7 (matrilysin, uterine)
Omim ID
178990Gene Ontology
HyperlinkGene Summary
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades proteoglycans, fibronectin, elastin and casein and differs from most MMP family members in that it lacks a conserved C-terminal protein domain. The enzyme is involved in wound healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. [provided by RefSeq
Other Designations
matrin|matrix metalloproteinase 7|matrix metalloproteinase 7 (matrilysin, uterine)|uterine matrilysin
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Identification of putative immunologic targets for colon cancer prevention based on conserved gene expression from pre-invasive to malignant lesions.
Broussard EK, Kim R, Wiley JC, Marquez JP, Annis JE, Pritchard D, Disis ML.
Cancer Prevention Research (Philadelphia, Pa.) 2013 Jul; 6(7):666.
Application:WB, WB-Tr, Human, Serum, HCT116, LoVo, RKO, SW48, FET, SW480 cells.
-
Identification of putative immunologic targets for colon cancer prevention based on conserved gene expression from pre-invasive to malignant lesions.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com