MMP1 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human MMP1 protein.
Immunogen
MMP1 (NP_002412.1, 1 a.a. ~ 469 a.a) full-length human protein.
Sequence
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (59); Rat (58)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
MMP1 MaxPab rabbit polyclonal antibody. Western Blot analysis of MMP1 expression in human pancreas.Western Blot (Transfected lysate)
Western Blot analysis of MMP1 expression in transfected 293T cell line (H00004312-T01) by MMP1 MaxPab polyclonal antibody.
Lane 1: MMP1 transfected lysate(54.00 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab rabbit antibody to MMP1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of MMP1 transfected lysate using anti-MMP1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with MMP1 purified MaxPab mouse polyclonal antibody (B01P) (H00004312-B01P). -
Gene Info — MMP1
Entrez GeneID
4312GeneBank Accession#
NM_002421Protein Accession#
NP_002412.1Gene Name
MMP1
Gene Alias
CLG, CLGN
Gene Description
matrix metallopeptidase 1 (interstitial collagenase)
Gene Ontology
HyperlinkGene Summary
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene encodes a secreted enzyme which breaks down the interstitial collagens, types I, II, and III. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. Alternative splicing results in multiple transcript variants.[provided by RefSeq
Other Designations
fibroblast collagenase|interstitial collagenase|matrix metalloprotease 1|matrix metalloproteinase 1|matrix metalloproteinase 1 (interstitial collagenase)
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
The effect of dehydroglyasperin C on UVB-mediated MMPs expression in human HaCaT cells.
Xuan SH, Park YM, Ha JH, Jeong YJ, Park SN.
Pharmacological Reports : PR 2017 Dec; 69(6):1224.
Application:WB-Ce, Human, HaCaT cells.
-
Licoricidin, an isoflavonoid isolated from Glycyrrhiza uralensis Fisher, prevents UVA-induced photoaging of human dermal fibroblasts.
Kim KJ, Xuan SH, Park SN.
International Journal of Cosmetic Science 2016 Aug; [Epub].
Application:WB-Ce, Human, Human dermal fibroblasts (HDFs).
-
The effect of dehydroglyasperin C on UVB-mediated MMPs expression in human HaCaT cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com