MAP3K11 monoclonal antibody (M02), clone 3D11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MAP3K11.
Immunogen
MAP3K11 (NP_002410, 741 a.a. ~ 847 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PPPGTSRSAPGTPGTPRSPPLGLISRPRPSPLRSRIDPWSFVSAGPRPSPLPSPQPAPRRAPWTLFPDSDPFWDSPPANPFQGGPQDCRAQTKDMGAQAPWVPEAGP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.51 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MAP3K11 expression in transfected 293T cell line by MAP3K11 monoclonal antibody (M02), clone 3D11.
Lane 1: MAP3K11 transfected lysate(92.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MAP3K11 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MAP3K11 is 0.1 ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CDC42 and MAP3K11. HeLa cells were stained with anti-CDC42 rabbit purified polyclonal 1:1200 and anti-MAP3K11 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — MAP3K11
Entrez GeneID
4296GeneBank Accession#
NM_002419Protein Accession#
NP_002410Gene Name
MAP3K11
Gene Alias
MGC17114, MLK-3, MLK3, PTK1, SPRK
Gene Description
mitogen-activated protein kinase kinase kinase 11
Omim ID
600050Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the serine/threonine kinase family. This kinase contains a SH3 domain and a leucine zipper-basic motif. This kinase preferentially activates MAPK8/JNK kinase, and functions as a positive regulator of JNK signaling pathway. This kinase can directly phosphorylate, and activates IkappaB kinase alpha and beta, and is found to be involved in the transcription activity of NF-kappaB mediated by Rho family GTPases and CDC42. [provided by RefSeq
Other Designations
SH3 domain-containing proline-rich kinase|mixed lineage kinase 3|protein-tyrosine kinase PTK1
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com